Glp-1 (7-37) k34r peptide 1 mg
Produit ni repris ni échangé excepté en cas d’erreur du prestataire.
Points clés
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq]
Garantie
Garantie 0 Mois
Description
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq]
Caractéristiques
- Domaine de recherche
- protéomique
- Fournisseur
- FISHER SCIENTIFIC S.A.S.
- Marque
- ABNOVA
- Référence fabricant
- P6193
- Référence distributeur
- 16141900
- Vendu par
- 1 mg
- Quantité
- N/A
- Lieu de fabrication
- Taiwan
- Lieu de stockage
- France
- Délai de péremption à la date de livraison
- 12 mois
- Code à barre
- non
- Soumis à carboglace
- oui
- Libellé produit fabricant
- 1mg glp-1 (7-37) k34r peptide
- Certification
- RUO
- Marquage CE DIV
- non
- Type de produit
- protéine
- Type de protéine
- non
- Type d'antibiotique
- non
- Type d'enzyme
- non
- Température de conservation (°C)
- -192 °C
- Température de transport
- carboglace
- Dispositif stérile
- non
- Type d'acide nucléique extrait
- non
- Origine humaine
- non
- Sans composant animal
- non
- Matière dangereuse
- non
- Autres caractéristiques
- Abnova GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag, Quantity: 1 mg, Common Name: GLP-1 (7-37) K34R peptide, Description: GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag expressed in
- Classification REACH
- non
- Code douanier
- 38229000
- Nomenclature Nacres
- NA.26
- Nomenclature CEA
- SGP01
- Nomenclature IRSN
- 273
- Nomenclature INSERM
- NA.NA26
- Nomenclature CNRS
- NA26
- Nomenclature CHU
- 18.551
- Nomenclature DGOS
- LD10AOOO
- Type d'échantillon
- protéine
- Reprise en cas d’erreur client
- non
- Type d’application
- ELISA, Western-Blot